About

Lover of Comic Books, Movies, Food and Baseball.

Podcaster of comics and movies amongst other things.

You can find the other places I am at here.

Search keywords

Following

chicgonegeekfuckyeahmoleskinesstevemarmelagentmlovestacossamhumphriesthehappysorceressthecutecookashcanallstarspeterjohnriosconfessions123midihaunted-by-youjillthompsongastrogirlirreliveranceladiesmakingcomicsgoddamnchrisjohnsonheyoscarwildefuzzytypewritermagnetgirldanfaustcharmingtillthelastlatimesmadmendailybernardinkawaiilibrarianeatakubradheitmeyergingerhazecrepesofwrathdcwomenkickingasstonedcurvesjbacardiisipaninibeckycloonaniamhannahsoniaharrishaniemohddcujonhochemikeromomizzellejacquelineofalltradesmelissakayzphoning-it-indailywonderwomangoboagnesgarbowskathwipsterawesomepeoplereadingthebdagpowercomboincogvitokalinarabrianwoodfashiontipsfromcomicstripskannayapatloikaphilnotodailydivadrawingdrinksfordrinkersthehealthyfoodieluckysipecookbakeeatduss005joekeatingelaurennmccwomanthologypiscespaulgeektroopercriterioncornerjennirlgraphiclygirlslovesuperheroescomixdc-whos-whohomemadecomicsshakeandstrainblogjonstumplushladypaperkegfiftyfiftymemanyamanblogelectricv01foodfuckerypinksagefyreball13wonderalithebirdandthebatbeckadoodleskellysuetally-artchrislikeslinksmrhippdrawblairdrawballsmoketwystcheaper-than-therapycartoonretrohellyeahrecipescomicsalliancemikemaihackmckelviemarksablecomicimpactderekreynoldstheresa-whofoodspottingfunramaerictrautmannturntable-fmcolemanranahanchrisrohlingawesomepeoplehangingouttogethermisschrissylynncliffchiangbeautifulnoise1wugazistarwarsandwinejoellejonesjoeyheflichhoplitewonderwomandavidapricejurassicaliensmileandribbonkungfupussygaloregeokundannylemmonsmaukingbirdcomicbycomicariesgamergirldefinitelyfarfromkoreacortomaljohnnydizzlexebixladywitalentberrywomenreadcomicsinpublic

Liked posts

See more stuff I like

Follow me

↓ Navigate ↓

HAR?

themed by Cherrie H.

My Soap Box

Not to mention Bourbon or Whiskey as well. :)

Source: whereisthecoool

Not to mention Bourbon or Whiskey as well. :)

(via crepesofwrath)

29th Jan 2012 (10:02 am) - Reblogged from Where is the Cool?

zaraillustrates:

AARP The Magazine recently commissioned me to illustrate an article about how flu shots can reduce the risk of heart disease. The art director already had a concept in mind that they wanted illustrated (though this is an alternative version - the original heart design had an additional smiling face motif). I have to admit that I’ve never been asked to illustrate vaccination in a “warm and inviting” way before but hopefully I achieved this!

Source: zaraillustrates

zaraillustrates:


AARP The Magazine recently commissioned me to illustrate an article about how flu shots can reduce the risk of heart disease.

The art director already had a concept in mind that they wanted illustrated (though this is an alternative version - the original heart design had an additional smiling face motif). I have to admit that I’ve never been asked to illustrate vaccination in a “warm and inviting” way before but hopefully I achieved this!

28th Jan 2012 (10:00 am) - Reblogged from Zara Illustrates

I don’t care if it clashes! I like it and it’s pretty!  (Taken with instagram)

I don’t care if it clashes! I like it and it’s pretty! (Taken with instagram)

27th Jan 2012 (2:36 pm) - By acomicbookgirl

astrume:

Just a fun sketch of my favorite JLU couple. Diana & Bruce OTP!!!! Though I have to say Black Canary and Green Arrow come close :)

Source: astrume

astrume:

Just a fun sketch of my favorite JLU couple. Diana & Bruce OTP!!!! Though I have to say Black Canary and Green Arrow come close :)

27th Jan 2012 (10:00 am) - Reblogged from Hug Me With Your Eyes

It was bound to happen.. What else can you buy for 45 cents? Its still a good deal regardless. 
latimes:

Philippe’s 9-cent coffee about to become history: The L.A. restaurant announces it will raise the price of a cup o’ joe to 45 cents on Feb. 2 because of the rising cost of its supply. Customers of the French dip palace wonder what took so long.
It’s the end of an era…
Photo:  A sign advertises the 9-cent coffee at Philippe the Original just north of downtown Los Angeles. Credit: Christina House / For The Times

Source: Los Angeles Times

It was bound to happen.. What else can you buy for 45 cents? Its still a good deal regardless.

latimes:

Philippe’s 9-cent coffee about to become history: The L.A. restaurant announces it will raise the price of a cup o’ joe to 45 cents on Feb. 2 because of the rising cost of its supply. Customers of the French dip palace wonder what took so long.

It’s the end of an era…

Photo: A sign advertises the 9-cent coffee at Philippe the Original just north of downtown Los Angeles. Credit: Christina House / For The Times

26th Jan 2012 (7:33 pm) - Reblogged from Los Angeles Times